MTCH2_HUMAN


Gene
Sequence
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI
Molecular Function positive regulation of apoptotic process;protein localization to mitochondrion;
EMBL Protein ID AAQ88168.1; AAD52646.1; AAD40196.1; BAG35865.1; EAW67892.1; AAH00875.1
UniProt MTCH2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / mitochondrial carrier (TC 2.A.29) family
iProClass Q9Y6C9
Pfam PF00153 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9Y6C9
CasaDB MTCH2_HUMAN

Database