CSDC2_HUMAN


Gene
Sequence
MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
Molecular Function F:mRNA 3'-UTR binding;F:RNA binding;F:transcription factor binding;mRNA processing;regulation of mRNA stability;
EMBL Protein ID BAA84704.1; CAG30343.1; CAD39079.2; -; AAH67113.1
UniProt CSDC2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q9Y534  (Superfamily:calcium-regulated heat stable protein 1)
Pfam PF00313 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9Y534
CasaDB CSDC2_HUMAN

Database