NSG2_HUMAN


Gene
Sequence
MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
Molecular Function F:clathrin light chain binding;clathrin coat assembly;dopamine receptor signaling pathway;endosomal transport;
EMBL Protein ID AAD30539.1; AAF14874.1; BAG35277.1; EAW61383.1; EAW61384.1; AAH02619.1
UniProt NSG2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / NSG family
iProClass Q9Y328  (Superfamily:neuron specific protein/calcyon)
Pfam PF06387 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9Y328
CasaDB NSG2_HUMAN

Database