STEA1_HUMAN


Gene
Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Molecular Function F:channel activity;F:metal ion binding;F:oxidoreductase activity;F:transporter activity;ion transport;iron ion homeostasis;
EMBL Protein ID AAF17479.1; -; AAD15620.2; EAL24167.1; AAH11802.1
UniProt STEA1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / STEAP family
iProClass Q9UHE8
Pfam PF01794 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9UHE8
CasaDB STEA1_HUMAN

Database