UXT_HUMAN


Gene
Sequence
MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Molecular Function F:beta-tubulin binding;F:chromatin binding;F:microtubule binding;F:transcription coregulator activity;F:transcription corepressor activity;apoptotic process;centrosome cycle;microtubule cytoskeleton organization;mitochondrion transport along microtubule;negative regulation of G0 to G1 transition;negative regulation of transcription by RNA polymerase II;
EMBL Protein ID AAD28698.1; AAD39839.1; AAD39840.1; BAG35008.1; -; EAW59325.1; EAW59326.1; AAH00720.1; AAH08890.1
UniProt UXT_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / UXT family
iProClass Q9UBK9
Pfam PF02996 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9UBK9
CasaDB UXT_HUMAN

Database