MBD2_HUMAN


Gene
Sequence
MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Molecular Function F:C2H2 zinc finger domain binding;F:chromatin binding;F:methyl-CpG binding;F:mRNA binding;F:protein domain specific binding;F:satellite DNA binding;F:siRNA binding;aging;ATP-dependent chromatin remodeling;cellular protein-containing complex assembly;cellular response to organic cyclic compound;chromatin silencing at rDNA;embryonic organ development;heart development;maternal behavior;methylation-dependent chromatin silencing;negative regulation of transcription by RNA polymerase II;negative regulation of transcription, DNA-templated;positive regulation of chromatin binding;positive regulation of Wnt signaling pathway;regulation of cell population proliferation;regulation of DNA methylation;response to estradiol;response to mechanical stimulus;response to nutrient levels;
EMBL Protein ID AAC68871.1; AAC68875.1; AAD56596.1; AAD56597.1; AAH32638.1
UniProt MBD2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q9UBB5
Pfam PF01429  PF14048  PF16564 
Google Search scholar keyword

Database