AHSP_HUMAN


Gene
Sequence
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Molecular Function F:hemoglobin binding;F:unfolded protein binding;erythrocyte differentiation;hemoglobin metabolic process;hemopoiesis;protein folding;protein stabilization;
EMBL Protein ID AAK50856.1; AAF64279.1; AAL82894.1; AAO49381.1; AAH35842.1
UniProt AHSP_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / AHSP family
iProClass Q9NZD4
Pfam PF09236 
Google Search scholar keyword

Database