CLC5A_HUMAN


Gene
Sequence
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Molecular Function F:carbohydrate binding;F:virus receptor activity;cellular defense response;innate immune response;myeloid cell differentiation;negative regulation of apoptotic process;negative regulation of myeloid cell apoptotic process;neutrophil degranulation;osteoblast development;positive regulation of cytokine secretion;signal transduction;
EMBL Protein ID AAF02491.1; CAB71334.1; AAS07444.1; AAH93714.1; AAI12100.1; AAI13099.1
UniProt CLC5A_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q9NY25
Pfam PF00059 
Google Search scholar keyword
PDBj 2YHF
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9NY25
CasaDB CLC5A_HUMAN

Database