FKB14_HUMAN


Gene
Sequence
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
Molecular Function F:calcium ion binding;F:peptidyl-prolyl cis-trans isomerase activity;IRE1-mediated unfolded protein response;
EMBL Protein ID AAQ89006.1; BAA91351.1; AAH05206.1
UniProt FKB14_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q9NWM8
Pfam PF13499  PF00254 
Google Search scholar keyword
PDBj 4DIP 4MSP
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9NWM8
CasaDB FKB14_HUMAN

Database