TM38B_HUMAN


Gene
Sequence
MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISSWFTAMLHCFGGGILSCLLLAEPPLKFLANHTNILLASSIWYITFFCPHDLVSQGYSYLPVQLLASGMKEVTRTWKIVGGVTHANSYYKNGWIVMIAIGWARGAGGTIITNFERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMFLYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE
Molecular Function F:potassium channel activity;bone development;bone mineralization;cellular response to caffeine;endoplasmic reticulum organization;extracellular matrix constituent secretion;lung alveolus development;lung epithelial cell differentiation;phospholipid biosynthetic process;regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion;release of sequestered calcium ion into cytosol by sarcoplasmic reticulum;secretion by lung epithelial cell involved in lung growth;
EMBL Protein ID BAA91645.1; CAG33539.1; -; AAH00049.1
UniProt TM38B_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / TMEM38 family
iProClass Q9NVV0
Pfam PF05197 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9NVV0
CasaDB TM38B_HUMAN

Database