CHRC1_HUMAN


Gene
Sequence
MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Molecular Function F:DNA binding;F:DNA-directed DNA polymerase activity;F:protein heterodimerization activity;chromatin remodeling;
EMBL Protein ID AAF72416.1; BAB14601.1; AAH15891.1
UniProt CHRC1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q9NRG0
Pfam PF00808 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9NRG0
CasaDB CHRC1_HUMAN

Database