NGB_HUMAN


Gene
Sequence
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Molecular Function F:heme binding;F:metal ion binding;F:oxygen binding;F:oxygen carrier activity;apoptotic process;oxygen transport;
EMBL Protein ID CAC12994.1; CAC11133.1; AAL98923.1; AAL98924.1; AAF63183.1; AAF62557.1; AAH32509.1
UniProt NGB_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / globin family
iProClass Q9NPG2  (Superfamily:globin)
Pfam PF00042 
Google Search scholar keyword
PDBj 1OJ6 4MPM
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9NPG2
CasaDB NGB_HUMAN

Database