RM44_HUMAN


Gene
Sequence
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS
Molecular Function F:double-stranded RNA binding;F:ribonuclease III activity;F:RNA binding;mitochondrial translational elongation;mitochondrial translational termination;pre-miRNA processing;primary miRNA processing;production of siRNA involved in RNA interference;RNA processing;
EMBL Protein ID BAB14234.1; BAB14802.1; CAG33574.1; AAY14925.1; AAH12058.1
UniProt RM44_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / ribonuclease III family
iProClass Q9H9J2
Pfam
Google Search scholar keyword
PDBj 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9H9J2
CasaDB RM44_HUMAN

Database