GREM2_HUMAN


Gene
Sequence
MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
Molecular Function F:BMP binding;F:cytokine activity;F:heparin binding;F:identical protein binding;BMP signaling pathway;cytokine-mediated signaling pathway;determination of dorsal identity;embryonic body morphogenesis;regulation of cytokine activity;sequestering of BMP from receptor via BMP binding;
EMBL Protein ID BAB15026.1; -; AAH46632.1
UniProt GREM2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / DAN family
iProClass Q9H772  (Superfamily:gremlin precursor)
Pfam PF03045 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9H772
CasaDB GREM2_HUMAN

Database