MIXL1_HUMAN


Gene
Sequence
MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
Molecular Function F:cis-regulatory region sequence-specific DNA binding;F:DNA-binding transcription activator activity, RNA polymerase II-specific;F:DNA-binding transcription factor activity, RNA polymerase II-specific;F:protein homodimerization activity;F:RNA polymerase II cis-regulatory region sequence-specific DNA binding;F:RNA polymerase II repressing transcription factor binding;F:RNA polymerase II transcription factor binding;cell migration involved in gastrulation;digestive tract development;endoderm development;endodermal cell differentiation;gastrulation;heart development;hematopoietic progenitor cell differentiation;negative regulation of hematopoietic progenitor cell differentiation;positive regulation of mesoderm development;positive regulation of transcription by RNA polymerase II;
EMBL Protein ID AAG35776.1; AAK01479.1; -; EAW69778.1; AAI11975.1; AAI13442.1; AAI43785.1
UniProt MIXL1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / paired homeobox family
iProClass Q9H2W2
Pfam PF00046 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9H2W2
CasaDB MIXL1_HUMAN

Database