UN93B_HUMAN


Gene
Sequence
MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPYLLVFQAIFYSFFHLSFACAQLPMIYFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLPRSGNLIVVESVLMAVAFLAMLLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIYSGFEVLFACTGIALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWLPRPVPLVAGAGVHLLLTFILFFWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDESDAEGEHGDGAEEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ
Molecular Function F:Toll-like receptor binding;adaptive immune response;defense response to virus;innate immune response;intracellular protein transport;toll-like receptor 3 signaling pathway;toll-like receptor 7 signaling pathway;toll-like receptor 9 signaling pathway;toll-like receptor signaling pathway;
EMBL Protein ID CAC19791.1; AAD15416.1; AAH92472.1; AAI01569.1; AAI05105.1; CAD19522.1
UniProt UN93B_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / unc-93 family
iProClass Q9H1C4
Pfam PF05978 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9H1C4
CasaDB UN93B_HUMAN

Database