STRAB_HUMAN


Gene
Sequence
MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
Molecular Function F:ATP binding;activation of protein kinase activity;cell cycle arrest;cell morphogenesis;negative regulation of extrinsic apoptotic signaling pathway in absence of ligand;protein export from nucleus;protein phosphorylation;
EMBL Protein ID BAB32500.1; AAM19143.1; AAF71042.1; BAB55254.1; AAY14692.1; AAH08302.1; AAH90871.1
UniProt STRAB_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / STE Ser/Thr protein kinase family
iProClass Q9C0K7
Pfam PF00069 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9C0K7
CasaDB STRAB_HUMAN

Database