KR171_HUMAN


Gene
Sequence
MGCCPGDCFTCCTQEQNCCEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSSCCGSGCGGCGGCGGCGGGCCGSSCCGSSCCGSGCCGPVCCQPTPICDTK
Molecular Function keratinization;
EMBL Protein ID CAC27591.1; AAH69297.1; AAH69078.1
UniProt KR171_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q9BYP8
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9BYP8
CasaDB KR171_HUMAN

Database