MND1_HUMAN


Gene
Sequence
MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID
Molecular Function F:double-stranded DNA binding;reciprocal meiotic recombination;
EMBL Protein ID AAK26168.1; BAG35106.1; EAX04964.1; EAX04965.1; AAH32142.1
UniProt MND1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / MND1 family
iProClass Q9BWT6  (Superfamily:meiotic nuclear division protein 1)
Pfam PF18517  PF03962 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9BWT6
CasaDB MND1_HUMAN

Database