SCNM1_HUMAN


Gene
Sequence
MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD
Molecular Function F:enzyme binding;F:metal ion binding;alternative mRNA splicing, via spliceosome;RNA splicing;
EMBL Protein ID BAB71149.1; BAG63123.1; -; AAH00264.1
UniProt SCNM1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q9BWG6
Pfam PF15805  PF15803 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9BWG6
CasaDB SCNM1_HUMAN

Database