DHRS4_HUMAN


Gene
Sequence
MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Molecular Function F:3-keto sterol reductase activity;F:alcohol dehydrogenase [NAD(P)+] activity;F:carbonyl reductase (NADPH) activity;F:identical protein binding;F:oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor;alcohol metabolic process;cellular ketone metabolic process;oxidation-reduction process;protein targeting to peroxisome;steroid metabolic process;
EMBL Protein ID AAD02292.1; BAB18775.1; AAL61824.2; AAQ13444.1; AAT70757.1; ABD75823.1; AAX49568.1; ABC61320.1; ABC61321.1; BAA91953.1; BAG37057.1; AAQ89001.1; -; AAH03019.1
UniProt DHRS4_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / short-chain dehydrogenases/reductases (SDR) family
iProClass Q9BTZ2
Pfam PF13561 
Google Search scholar keyword
PDBj 3O4R
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q9BTZ2
CasaDB DHRS4_HUMAN

Database