TR13C_HUMAN


Gene
Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Molecular Function adaptive immune response;B cell costimulation;B cell homeostasis;positive regulation of B cell proliferation;positive regulation of germinal center formation;positive regulation of interferon-gamma biosynthetic process;positive regulation of T cell proliferation;T cell costimulation;tumor necrosis factor-mediated signaling pathway;
EMBL Protein ID AAK91826.1; -
UniProt TR13C_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q96RJ3  (Superfamily:tumor necrosis factor receptor superfamily member 13C)
Pfam PF09256 
Google Search scholar keyword
PDBj 1MPV 1OQE 1OSX 2HFG 3V56 4V46
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96RJ3
CasaDB TR13C_HUMAN

Database