ERMAP_HUMAN


Gene
Sequence
MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Molecular Function F:signaling receptor binding;regulation of cytokine production;regulation of immune response;T cell receptor signaling pathway;
EMBL Protein ID AAL11456.1; AAL08411.1; AAL08412.1; CAD43739.1; CAD43740.1; CAD43741.1; CAD97613.2; AAY88736.1; -; EAX07130.1; EAX07133.1; AAH99703.1; AAH99707.1; AAH99712.1; AAH99713.1; AAT66409.1
UniProt ERMAP_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / BTN/MOG family
iProClass Q96PL5
Pfam PF13765  PF00622  PF07686 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96PL5
CasaDB ERMAP_HUMAN

Database