GNRR2_HUMAN


Gene
Sequence
MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Molecular Function F:G protein-coupled receptor activity;F:gonadotropin-releasing hormone receptor activity;F:peptide binding;cellular response to hormone stimulus;G protein-coupled receptor signaling pathway;
EMBL Protein ID AAL27000.1; AAL89821.1; -
UniProt GNRR2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / G-protein coupled receptor 1 family
iProClass Q96P88  (Superfamily:rhodopsin-like G protein-coupled receptors)
Pfam PF00001 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96P88
CasaDB GNRR2_HUMAN

Database