TMM83_HUMAN


Gene
Sequence
MNCDALLHHSAIPEDFLHIFLLLQKISVSLPLSLSQSVCLFYSISLCVSLLLHISLCVSVYVSLSLSSFPCFSLTHTHTHSQLSKDTSVLTFTFCFKQHTHFTLNYTSHAHELSAPSVHPTCVFTFKAAPSPRPAT
Molecular Function
EMBL Protein ID BAB71075.1
UniProt TMM83_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q96N35
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96N35
CasaDB TMM83_HUMAN

Database