ABHEB_HUMAN


Gene
Sequence
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
Molecular Function F:hydrolase activity;3'-phosphoadenosine 5'-phosphosulfate metabolic process;positive regulation of transcription by RNA polymerase II;
EMBL Protein ID BAC11366.1; BAC11408.1; BAC04696.1; AAH07234.1; AAH50650.1; AAH56411.1
UniProt ABHEB_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / ABHD14 family
iProClass Q96IU4
Pfam PF12697 
Google Search scholar keyword
PDBj 1IMJ
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96IU4
CasaDB ABHEB_HUMAN

Database