COA8_HUMAN


Gene
Sequence
MLPCAAGARGRGAMVVLRAGKKTFLPPLCRAFACRGCQLAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Molecular Function intrinsic apoptotic signaling pathway;mitochondrial respiratory chain complex IV assembly;negative regulation of reactive oxygen species biosynthetic process;positive regulation of cysteine-type endopeptidase activity involved in apoptotic process;positive regulation of cytochrome-c oxidase activity;positive regulation of release of cytochrome c from mitochondria;positive regulation of smooth muscle cell apoptotic process;protein stabilization;response to reactive oxygen species;
EMBL Protein ID -; -; BAD96812.1; BAD96823.1; AAH07412.1
UniProt COA8_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / COA8 family
iProClass Q96IL0
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96IL0
CasaDB COA8_HUMAN

Database