NUD11_HUMAN


Gene
Sequence
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
Molecular Function F:bis(5'-adenosyl)-hexaphosphatase activity;F:bis(5'-adenosyl)-pentaphosphatase activity;F:diphosphoinositol-polyphosphate diphosphatase activity;F:endopolyphosphatase activity;F:inositol diphosphate pentakisphosphate diphosphatase activity;F:inositol diphosphate tetrakisphosphate diphosphatase activity;F:m7G(5')pppN diphosphatase activity;F:metal ion binding;adenosine 5'-(hexahydrogen pentaphosphate) catabolic process;diadenosine hexaphosphate catabolic process;diadenosine pentaphosphate catabolic process;diphosphoinositol polyphosphate metabolic process;inositol phosphate metabolic process;
EMBL Protein ID BAA91720.1; -; AAH09942.1
UniProt NUD11_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / Nudix hydrolase family
iProClass Q96G61
Pfam PF00293 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96G61
CasaDB NUD11_HUMAN

Database