NGBR_HUMAN


Gene
Sequence
MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
Molecular Function F:dehydrodolichyl diphosphate synthase activity;angiogenesis;cell differentiation;cholesterol homeostasis;dolichol biosynthetic process;dolichyl diphosphate biosynthetic process;positive regulation of blood vessel endothelial cell migration;positive regulation of nitric-oxide synthase activity;protein mannosylation;regulation of intracellular cholesterol transport;vascular endothelial growth factor signaling pathway;
EMBL Protein ID -; -; EAW48201.1; AAH13026.1; AAH63794.1; AAH66910.1; AAI10326.1; AAI50655.1; AAI50656.1; AAB72234.1
UniProt NGBR_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / UPP synthase family
iProClass Q96E22
Pfam PF01255 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q96E22
CasaDB NGBR_HUMAN

Database