S35B4_HUMAN


Gene
Sequence
MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPVIGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTTKSEPQKDSKKN
Molecular Function F:transmembrane transporter activity;F:UDP-N-acetylglucosamine transmembrane transporter activity;F:UDP-xylose transmembrane transporter activity;carbohydrate transport;regulation of gluconeogenesis;UDP-N-acetylglucosamine transmembrane transport;UDP-xylose transmembrane transport;
EMBL Protein ID CAI98963.1; BAB61040.1; CAC84567.1; CAC84568.1; BAB55225.1; BAB55325.1; BAC11573.1; BAD96594.1; -; EAL24071.1; EAW83810.1; AAH08413.1
UniProt S35B4_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / nucleotide-sugar transporter family
iProClass Q969S0  (Superfamily:solute carrier family 35, member B type)
Pfam PF08449 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q969S0
CasaDB S35B4_HUMAN

Database