KCNJ9_HUMAN


Gene
Sequence
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Molecular Function F:G-protein activated inward rectifier potassium channel activity;F:inward rectifier potassium channel activity;potassium ion import across plasma membrane;regulation of ion transmembrane transport;
EMBL Protein ID AAB07043.1; AAF89098.1; -
UniProt KCNJ9_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / inward rectifier-type potassium channel (TC 1.A.2.1) family
iProClass Q92806  (Superfamily:G protein-activated inward rectifier potassium channel)
Pfam PF01007  PF17655 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q92806
CasaDB KCNJ9_HUMAN

Database