PHF10_HUMAN


Gene
Sequence
MAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETSSQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
Molecular Function F:histone acetyltransferase activity;F:histone binding;F:metal ion binding;negative regulation of transcription, DNA-templated;nervous system development;positive regulation of transcription by RNA polymerase II;
EMBL Protein ID -; AAH20954.1; AAI10324.1; AAK27451.1; BAA91934.1; CAG33554.1; BAD96332.1
UniProt PHF10_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / SAYP family
iProClass Q8WUB8
Pfam PF00628 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q8WUB8
CasaDB PHF10_HUMAN

Database