CLC1A_HUMAN


Gene
Sequence
MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
Molecular Function F:carbohydrate binding;F:transmembrane signaling receptor activity;cell surface receptor signaling pathway;defense response;
EMBL Protein ID AAF36830.1; AAQ88950.1; BAC11410.1; AAH39072.1; AAH67746.1
UniProt CLC1A_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q8NC01  (Superfamily:natural killer receptor Ly49)
Pfam PF00059 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q8NC01
CasaDB CLC1A_HUMAN

Database