ZN610_HUMAN


Gene
Sequence
MLCDEEAQKRKAKESGMALPQGRLTFMDVAIEFSQEEWKSLDPGQRALYRDVMLENYRNLVFLGICLPDLSIISMLKQRREPLILQSQVKIVKNTDGRECVRSVNTGRSCVLGSNAENKPIKNQLGLTLEAHLSELQLFQAGRKIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYRNDLIDFPLLPQEEKAYIRGKSYEYECSEDGEVFRVRASLTNHQVIHTAEKPYKCTECGKVFSRNSHLVEHWRIHTGQKPYKCSECDKVFNRNSNLARHQRIHTGEKPHKCNECGKAFRECSGLTTHLVIHTGEKPYKCNECGKNFRHKFSLTNHQRSHTAEKPYKCNECGKVFSLLSYLARHQIIHSTEKPYKCNECGRAFHKRPGLMAHLLIHTGEKPYKCNECDKVFGRKLYLTNHQRIHTGERPYKCNACGKVFNQNPHLSRHRKIHAGENSLRTLQME
Molecular Function F:DNA binding;F:metal ion binding;regulation of transcription, DNA-templated;
EMBL Protein ID BAF83577.1; BAC04144.1; -; AAH39903.1; AAI05968.1; CAD38559.1
UniProt ZN610_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / krueppel C2H2-type zinc-finger protein family
iProClass Q8N9Z0
Pfam PF01352  PF00096 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q8N9Z0
CasaDB ZN610_HUMAN

Database