OR8H3_HUMAN


Gene
Sequence
MMGRRNDTNVADFILTGLSDSEEVQMALFMLFLLIYLITMLGNVGMLLIIRLDLQLHTPMYFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQMFCFVFLGTAECYLLSSMAYDRYAAICSPLHYTVIMPKRLCLALITGPYVIGFMDSFVNVVSMSRLHFCDSNIIHHFFCDTSPILALSCTDTDNTEMLIFIIAGSTLMVSLITISASYVSILSTILKINSTSGKQKAFSTCVSHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNALIRVMQRRQDSR
Molecular Function F:G protein-coupled receptor activity;F:odorant binding;F:olfactory receptor activity;G protein-coupled receptor signaling pathway;sensory perception of smell;
EMBL Protein ID BAC05884.1; BAC06059.1; DAA04743.1
UniProt OR8H3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / G-protein coupled receptor 1 family
iProClass Q8N146  (Superfamily:rhodopsin-like G protein-coupled receptors)
Pfam PF13853 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q8N146
CasaDB OR8H3_HUMAN

Database