SIAH3_HUMAN


Gene
Sequence
MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTHNLKYVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTSLAQLFSDNGSLAIGIAITATEVLPSEAEM
Molecular Function F:metal ion binding;F:ubiquitin conjugating enzyme binding;F:ubiquitin protein ligase activity;multicellular organism development;negative regulation of protein targeting to mitochondrion;proteasome-mediated ubiquitin-dependent protein catabolic process;regulation of protein stability;ubiquitin-dependent protein catabolic process;
EMBL Protein ID -; AAH41372.2; BAC04809.1
UniProt SIAH3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / SINA (Seven in absentia) family
iProClass Q8IW03
Pfam PF03145 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q8IW03
CasaDB SIAH3_HUMAN

Database