CN165_HUMAN


Gene
Sequence
MFTLLLSNYYSRLEGWMMDNNFSHHWKGMFPTETESTVFCLFVYLFIFVFETASGFVAQTGVHWCNLGSLQPLPPGFKRFSCLSLPSSLDYRHAPPCLANFYIFSGDRVSPCWPDWS
Molecular Function
EMBL Protein ID CAD61903.1; -
UniProt CN165_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q86U02
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q86U02
CasaDB CN165_HUMAN

Database