SMIM5_HUMAN


Gene
Sequence
MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHCCCPERRGRKVQVQPTPP
Molecular Function
EMBL Protein ID AAQ15244.1; -; EAW89296.1
UniProt SMIM5_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q71RC9
Pfam PF15831 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q71RC9
CasaDB SMIM5_HUMAN

Database