SHLD3_HUMAN


Gene
Sequence
MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM
Molecular Function DNA repair;negative regulation of double-strand break repair via homologous recombination;positive regulation of double-strand break repair via nonhomologous end joining;positive regulation of isotype switching;
EMBL Protein ID BAC85360.1; -
UniProt SHLD3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q6ZNX1
Pfam
Google Search scholar keyword
PDBj 6K07 6K08 6KTO
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q6ZNX1
CasaDB SHLD3_HUMAN

Database