TX261_HUMAN


Gene
Sequence
MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
Molecular Function F:COPII adaptor activity;endoplasmic reticulum to Golgi vesicle-mediated transport;
EMBL Protein ID AAQ89143.1; EAW99783.1; EAW99785.1; AAH20251.2; AAI28462.1; AAI28463.1
UniProt TX261_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / SVP26 family
iProClass Q6UWH6
Pfam PF04148 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q6UWH6
CasaDB TX261_HUMAN

Database