ISK14_HUMAN


Gene
Sequence
MAKSFPVFSLLSFILIHLVLSSVSGPRHWWPPRGIIKVKCPYEKVNLSWYNGTVNPCPGLYQPICGTNFITYDNPCILCVESLKSHGRIRFYHDGKC
Molecular Function F:serine-type endopeptidase inhibitor activity;
EMBL Protein ID AFB83536.1; -; CAE51407.1
UniProt ISK14_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q6IE38  (Superfamily:pancreatic secretory trypsin inhibitor)
Pfam PF00050 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q6IE38
CasaDB ISK14_HUMAN

Database