CST9_HUMAN


Gene
Sequence
MSSPQRRKAMPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Molecular Function F:cysteine-type endopeptidase inhibitor activity;antimicrobial humoral response;
EMBL Protein ID AAM18055.1; -; AAI37303.1; AAI37304.1
UniProt CST9_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / cystatin family
iProClass Q5W186
Pfam PF00666 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q5W186
CasaDB CST9_HUMAN

Database