LELP1_HUMAN


Gene
Sequence
MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE
Molecular Function
EMBL Protein ID -; AAH87854.1; AAI30508.1; AAI30512.1
UniProt LELP1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / cornifin (SPRR) family
iProClass Q5T871
Pfam PF15042 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q5T871
CasaDB LELP1_HUMAN

Database