KRBX4_HUMAN


Gene
Sequence
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCAGEDRPEVWQVDEQIDHYKESQDKLPWQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVRQRLPKYYSWEKAFKTSFKLSWSKWKLCKKER
Molecular Function F:nucleic acid binding;regulation of transcription, DNA-templated;
EMBL Protein ID BAA91104.1; BAG53284.1; BAF82392.1; -; EAW59263.1; AAH12569.1
UniProt KRBX4_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q5JUW0
Pfam PF01352 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q5JUW0
CasaDB KRBX4_HUMAN

Database