GGEE3_HUMAN


Gene
Sequence
MSEHVRTRSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP
Molecular Function
EMBL Protein ID -; AAI30360.1
UniProt GGEE3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / GAGE family
iProClass Q5JRK9
Pfam PF05831 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q5JRK9
CasaDB GGEE3_HUMAN

Database