CTU2_HUMAN


Gene
Sequence
MCQVGEDYGEPAPEEPPPAPRPSREQKCVKCKEAQPVVVIRAGDAFCRDCFKAFYVHKFRAMLGKNRLIFPGEKVLLAWSGGPSSSSMVWQVLEGLSQDSAKRLRFVAGVIFVDEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGDVVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPSTVSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSPIPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLPPYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS
Molecular Function F:nucleotidyltransferase activity;F:sulfurtransferase activity;F:tRNA binding;protein urmylation;tRNA modification;tRNA thio-modification;tRNA wobble position uridine thiolation;tRNA wobble uridine modification;
EMBL Protein ID -; -; AAH80540.1; AAI08660.1; AAI21806.1; AAI25270.1; AAI57882.1
UniProt CTU2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / CTU2/NCS2 family
iProClass Q2VPK5
Pfam PF10288 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q2VPK5
CasaDB CTU2_HUMAN

Database