RN151_HUMAN


Gene
Sequence
MGGGYDLNLFASPPDSNFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVVHMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGCGATLDPAERARHNCYRELHNAWSVRQERRRPLLLSLLRRVRWLDQATSVVRRELAELSNFLEEDTALLEGAPQEEAEAAPEGNVGAEVVGEPRANIPCK
Molecular Function F:ubiquitin protein ligase activity;F:zinc ion binding;cell differentiation;protein ubiquitination;spermatogenesis;
EMBL Protein ID AAH29501.2; AAI13015.1
UniProt RN151_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q2KHN1
Pfam PF13923 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q2KHN1
CasaDB RN151_HUMAN

Database