ZNF67_HUMAN


Gene
Sequence
MLSHKTQHKSIYTREKSYKCKKCGKTFNWSSILTNNKKIHTEQKPYKCEECGKAFKQHSTLTTHKIICAEEKLYRCEECGKAFCQPSTLTRYKRMHRRKKLYKCEECGKAFTQFSTLTKHKRIHTRGKHYKCEESGKAFIWSSGLTEHRRVHTRQKPYKCEECGKALIQFSTLTRHKRIHTGEKPNKSMWQTF
Molecular Function F:metal ion binding;F:nucleic acid binding;
EMBL Protein ID -; AAA61334.1
UniProt ZNF67_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass Q15940
Pfam PF00096 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI Q15940
CasaDB ZNF67_HUMAN

Database