CSK2B_HUMAN


Gene
Sequence
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Molecular Function F:chromatin binding;F:identical protein binding;F:metal ion binding;F:protein domain specific binding;F:protein kinase regulator activity;F:protein serine/threonine kinase activity;F:ribonucleoprotein complex binding;F:signaling receptor binding;F:transcription factor binding;adiponectin-activated signaling pathway;cellular protein-containing complex assembly;endothelial tube morphogenesis;liver regeneration;macroautophagy;negative regulation of blood vessel endothelial cell migration;negative regulation of cell population proliferation;neutrophil degranulation;peptidyl-threonine phosphorylation;phosphatidylcholine biosynthetic process;positive regulation of activin receptor signaling pathway;positive regulation of pathway-restricted SMAD protein phosphorylation;protein folding;regulation of DNA binding;regulation of signal transduction by p53 class mediator;response to testosterone;signal transduction;Wnt signaling pathway;
EMBL Protein ID CAA34811.1; CAA34379.1; AAA52123.1; CAA40442.1; AAM50092.1; CAG46500.1; AAD18081.1; BAB63386.1; ABC40727.1; BAG34801.1; -; EAX03473.1; AAI12018.1; AAI12020.1
UniProt CSK2B_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / casein kinase 2 subunit beta family
iProClass P67870  (Superfamily:human casein kinase II beta chain)
Pfam PF01214 
Google Search scholar keyword

Database