H2B1C_HUMAN


Gene
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Molecular Function F:DNA binding;F:identical protein binding;F:protein heterodimerization activity;antibacterial humoral response;antimicrobial humoral immune response mediated by antimicrobial peptide;defense response to Gram-positive bacterium;innate immune response in mucosa;nucleosome assembly;protein ubiquitination;
EMBL Protein ID AAA63189.1; CAB02544.1; CAB02541.1; CAB02542.1; CAB02545.1; AAN06686.1; AAN06688.1; AAN06689.1; AAN06690.1; AAN06692.1; -; AAH96120.1; AAH96122.1; AAH96123.1; AAI01654.1; AAI01656.1; AAI01749.1; AAI01751.1; AAI06900.1
UniProt H2B1C_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / histone H2B family
iProClass P62807  (Superfamily:histone H2B)
Pfam PF00125 
Google Search scholar keyword

Database